Peptide medicine
Tesamorelin
Tesamorelin is a regulated peptide medicine with established evidence in defined indications.
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Formula
- C221H366N72O67S
- Molecular weight
- 5135.9 g/mol
Evidence confidence
Human
5/5
Strong human clinical evidence
4 citations
Animal
Not yet assessed
Trust Engine review pending.
Mechanistic
Not yet assessed
Trust Engine review pending — see editorial links below.
Editorial evidence links exist, but this category has not yet completed Trust Engine assessment.
Safety
4/5
Well-characterised safety
4 citations
Claimed uses
- Low to review
- Low to review
- Moderate
- Strong
- Strong
Mechanisms
Safety notes
Adverse effects, contraindications and monitoring requirements depend on the approved formulation and indication.
Regulation
- FDA-approved in the United States for reduction of excess abdominal fat in adults with HIV-associated lipodystrophy. It is not indicated for general weight-loss management.
- FDA-approved in the United States for reduction of excess abdominal fat in adults with HIV and lipodystrophy. It is not indicated for general weight-loss management, and availability differs internationally.
- Prescription or regulated medicine with jurisdiction-specific indications.
References
- EGRIFTA WR (tesamorelin) prescribing information · 2025
- Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation · 2014
- Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation · 2010
- Effects of Tesamorelin, a Growth Hormone-Releasing Factor, in HIV-Infected Patients with Abdominal Fat Accumulation: A Randomized Placebo-Controlled Trial with a Safety Extension · 2010
Last reviewed
12 July 2026